Paul.xu: Created page with "Use CPP to promote Transduction of Tat-Cre and Tat-Flp
1. Transfect 293T cells with reporters,
15ug---10cm plate
Cre: 2181 pCMV-LoxP-kozak-TurboRFP-ODC-2Stops-..."

2014-06-09T16:46:01Z

Created page with "Use CPP to promote Transduction of Tat-Cre and Tat-Flp 1. Transfect 293T cells with reporters, 15ug---10cm plate Cre: 2181 pCMV-LoxP-kozak-TurboRFP-ODC-2Stops-..."

New page

Use CPP to promote Transduction of Tat-Cre and Tat-Flp 

1. Transfect 293T cells with reporters, 

15ug---10cm plate 

Cre: 2181 pCMV-LoxP-kozak-TurboRFP-ODC-2Stops-LoxP-TurboGFP 

2. Split cells next day into 12  wells plate 

3. Add 0.5 μM Tat-Cre 

and add the following peptides at 5 μM, make sure there are negative controls (No tat-Cre/Tat-Flp, No peptide) 

R9-HA RRRRRRRRRGLFEAIEGFIENGWEGMIDGWYGC MW: 4100 

1 mg-->243.9 nmole, 1 mg in 1 ml--> 243.9 μM 

============= Tat-HA2 RRRQRRKKRGGDIMGEWGNEIFGAIAGFLGC MW: 3536 

1 mg-->285.7 nmole, 1 mg in 1 ml-->  μM ============= HA2-R9 GDIMGEWGNEIFGAIAGFLGGGRRRRRRRRRGC MW: 3735 

1 mg-->270 nmole, 1 mg in 1 ml--> 270 μM ============= Tat-IFN7 RRRQRRKKRGLFEAIEGFIENGWEGMIDGWYGC MW: 4016 

1 mg-->250 nmole, 1 mg in 1 ml--> 250μM

4. Incubate 36hours and take a picture of cells. Compare transduction efficiency.

[[Image:1Use_CPP_to_Promote_Transduction.JPG]] 

[[Category:QC]]

Use CPP to Promote Transduction CRE - Revision history

Paul.xu: Created page with "Use CPP to promote Transduction of Tat-Cre and Tat-Flp 1. Transfect 293T cells with reporters, 15ug---10cm plate Cre: 2181 pCMV-LoxP-kozak-TurboRFP-ODC-2Stops-..."

Paul.xu: Created page with "Use CPP to promote Transduction of Tat-Cre and Tat-Flp
1. Transfect 293T cells with reporters,
15ug---10cm plate
Cre: 2181 pCMV-LoxP-kozak-TurboRFP-ODC-2Stops-..."