Anti-Taq Antibody

From ELN
Revision as of 17:21, 28 February 2017 by Paul.xu (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

 Patent 5,338, 671

TP4

https://www.atcc.org/products/all/HB-11126.aspx

TP4-9.2

https://www.atcc.org/products/all/HB-11807.aspx

TP9: HB-11127

Taq: 250,000 units/mg of protein.

Taq_antibody: US5587287



Taq, Ka Tth, Ka Tfi, Ka
TP1 IgG1
 6.0E-09

TP2 IgG1
 5.0E-09
 3.0E-07
TP3 IgG2b
 2.5E-09
2.0E-08
TP4 IgG2a
 1.5E-09
 9.0E-09
TP5 IgG2b
 4.0E-09
 2.0E-08
TP6 IgG2b
 2.5E-09

TP7 IgG2a 
 1.0E-09
 8.0E-09
 8.0E-09
TP8 IgG2a 
 3.0E-09
 3.0E-08
TP9 IgG2a 
 1.8E-09
 1.0E-08 6.0E-09
TPl and TP6 have high affinity for

Thermus aquaticus DNA polymerase, but little affinity for the other two DNA polymerases. TP2, TP4, TP5 and TP8 have high a?'inity for the Thermus aquaticus and Thermus themzaphilus DNA polymerases. TP3 has high af?nity for the Thermus aquaticus and Thermus ?lzjformis DNA polymerases. TP7 and TP9 have high af?nity for all three DNA polymerases. 


>1BGX:H|PDBID|CHAIN|SEQUENCE
EVQLQESGPGLVKPYQSLSLSCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGTTDYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARYYYGYWYFDVWGQGTTLTVSS

>1BGX:L|PDBID|CHAIN|SEQUENCE
DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELK


==============

EVQLQESGPGLVKPYQSLSLSCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGTTDYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARYYYGYWYFDVWGQGTTLTVSSAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Description: Recombinant monoclonal antibody to Taq-Polymerase. Manufactured using
AbAb’s Recombinant Platform with variable regions (i.e. specificity) from the hybridoma
TP7.
This reformatted mouse antibody was made using the variable domain sequences of
the original Mouse IgG2a format, for improved compatibility with existing reagents,
assays and techniques.
Isotype and Format: Mouse IgG1, kappa
Clone Number: TP7



Mouse antibody kappa light chain


LOCUS       1BGX_L                   210 aa            linear   ROD 10-OCT-2012
DEFINITION  Chain L, Taq Polymerase In Complex With Tp7, An Inhibitory Fab.
ACCESSION   1BGX_L
VERSION     1BGX_L  GI:3891940
DBSOURCE    pdb: molecule 1BGX, chain 76, release Jun 18, 2009;
            deposition: Jun 2, 1998;
            class: Complex (PolymeraseINHIBITOR);
            source: Mmdb_id: 48162, Pdb_id 1: 1BGX;
            Exp. method: X-Ray Diffraction.
KEYWORDS    .
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (residues 1 to 210)
  AUTHORS   Murali,R., Helmer-Citterich,M., Sharkey,D.J., Scalice,E.R.,
            Daiss,J.L., Sullivan,M.A. and Krishna Murthy,H.M.
  TITLE     Structural studies on an inhibitory antibody against Thermus
            aquaticus DNA polymerase suggest mode of inhibition
  JOURNAL   Protein Eng. 11 (2), 79-86 (1998)
   PUBMED   9605541
REFERENCE   2  (residues 1 to 210)
  AUTHORS   Murali,R., Sharkey,D.J., Daiss,J.L. and Murthy,H.M.
  TITLE     Crystal structure of Taq DNA polymerase in complex with an
            inhibitory Fab: the Fab is directed against an intermediate in the
            helix-coil dynamics of the enzyme
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 95 (21), 12562-12567 (1998)
   PUBMED   9770525
REFERENCE   3  (residues 1 to 210)
  AUTHORS   Murali,R., Sharkey,D.J., Daiss,J.L. and Krishna Murthy,H.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-1998)
COMMENT     SEQRES.
FEATURES             Location/Qualifiers
     source          1..210
                     /organism="Mus musculus"
                     /db_xref="taxon:10090"
     Region          1..107
                     /region_name="Domain 7"
                     /note="NCBI Domains"
     Region          2..105
                     /region_name="Ig"
                     /note="Immunoglobulin domain; cl11960"
                     /db_xref="CDD:276006"
     SecStr          3..7
                     /sec_str_type="sheet"
                     /note="strand 21"
     Region          8..104
                     /region_name="IG_like"
                     /note="Immunoglobulin like; smart00410"
                     /db_xref="CDD:214653"
     SecStr          9..13
                     /sec_str_type="sheet"
                     /note="strand 22"
     SecStr          15..26
                     /sec_str_type="sheet"
                     /note="strand 23"
     Bond            bond(23,87)
                     /bond_type="disulfide"
     SecStr          31..38
                     /sec_str_type="sheet"
                     /note="strand 24"
     SecStr          43..50
                     /sec_str_type="sheet"
                     /note="strand 25"
     SecStr          51..54
                     /sec_str_type="sheet"
                     /note="strand 26"
     SecStr          60..67
                     /sec_str_type="sheet"
                     /note="strand 27"
     SecStr          68..74
                     /sec_str_type="sheet"
                     /note="strand 28"
     SecStr          75..78
                     /sec_str_type="sheet"
                     /note="strand 29"
     SecStr          82..89
                     /sec_str_type="sheet"
                     /note="strand 30"
     SecStr          100..105
                     /sec_str_type="sheet"
                     /note="strand 31"
     Region          108..210
                     /region_name="Domain 8"
                     /note="NCBI Domains"
     SecStr          110..119
                     /sec_str_type="sheet"
                     /note="strand 32"
     Region          111..210
                     /region_name="IgC_L"
                     /note="Immunoglobulin Constant domain; cd07699"
                     /db_xref="CDD:143323"
     Site            order(115..117,130,132,134,136..137,159..162,173..175,
                     206..207)
                     /site_type="other"
                     /note="heterodimer interface [polypeptide binding]"
                     /db_xref="CDD:143323"
     SecStr          127..139
                     /sec_str_type="sheet"
                     /note="strand 33"
     Bond            bond(133,193)
                     /bond_type="disulfide"
     Site            order(139,164..165,170)
                     /site_type="other"
                     /note="intrachain IgV interface"
                     /db_xref="CDD:143323"
     SecStr          143..150
                     /sec_str_type="sheet"
                     /note="strand 34"
     SecStr          151..154
                     /sec_str_type="sheet"
                     /note="strand 35"
     SecStr          157..163
                     /sec_str_type="sheet"
                     /note="strand 36"
     SecStr          171..180
                     /sec_str_type="sheet"
                     /note="strand 37"
     SecStr          181..188
                     /sec_str_type="helix"
                     /note="helix 22"
     SecStr          189..197
                     /sec_str_type="sheet"
                     /note="strand 38"
     SecStr          203..210
                     /sec_str_type="sheet"
                     /note="strand 39"
ORIGIN     

                                           32    34                  50       54    56  57
        1 diqmtqspai msaspgekvt mtcsasssvs y  m  y  wyqqkpg ssprlliy  d s tn  l a   s   g vpvr
                                           s91 92
       61 fsgsgsgtsy sltisrmeae daatyycqqw s   t  ypltfgag tklelkrada aptvsifpps
      121 seqltsggas vvcflnnfyp kdinvkwkid gserqngvln swtdqdskds tysmsstltl
      181 tkdeyerhns ytceathkts tspivksfnr


L1 (Y32 Y34)	      Y545 P548 D547	5  (1)	41
L2 (D50 L54 G56)	  E471 R536 I546	3  (3)	83
L3 (S91 S92)	      R313 K314	2  (2)	64



Chain H anti taq Tp7
 d1ay1h1   Immunoglobulin heavy chain variable domain, VH: 119 residues  
 d1ay1h2   Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma: 94 residues  
 


LOCUS       1BGX_H                   213 aa            linear   ROD 10-OCT-2012
DEFINITION  Chain H, Taq Polymerase In Complex With Tp7, An Inhibitory Fab.
ACCESSION   1BGX_H
VERSION     1BGX_H  GI:3891939
DBSOURCE    pdb: molecule 1BGX, chain 72, release Jun 18, 2009;
            deposition: Jun 2, 1998;
            class: Complex (PolymeraseINHIBITOR);
            source: Mmdb_id: 48162, Pdb_id 1: 1BGX;
            Exp. method: X-Ray Diffraction.
KEYWORDS    .
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (residues 1 to 213)
  AUTHORS   Murali,R., Helmer-Citterich,M., Sharkey,D.J., Scalice,E.R.,
            Daiss,J.L., Sullivan,M.A. and Krishna Murthy,H.M.
  TITLE     Structural studies on an inhibitory antibody against Thermus
            aquaticus DNA polymerase suggest mode of inhibition
  JOURNAL   Protein Eng. 11 (2), 79-86 (1998)
   PUBMED   9605541
REFERENCE   2  (residues 1 to 213)
  AUTHORS   Murali,R., Sharkey,D.J., Daiss,J.L. and Murthy,H.M.
  TITLE     Crystal structure of Taq DNA polymerase in complex with an
            inhibitory Fab: the Fab is directed against an intermediate in the
            helix-coil dynamics of the enzyme
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 95 (21), 12562-12567 (1998)
   PUBMED   9770525
REFERENCE   3  (residues 1 to 213)
  AUTHORS   Murali,R., Sharkey,D.J., Daiss,J.L. and Krishna Murthy,H.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-1998)
COMMENT     SEQRES.
FEATURES             Location/Qualifiers
     source          1..213
                     /organism="Mus musculus"
                     /db_xref="taxon:10090"
     Region          1..120
                     /region_name="Domain 9"
                     /note="NCBI Domains"
     Region          4..118
                     /region_name="Ig"
                     /note="Immunoglobulin domain; cl11960"
                     /db_xref="CDD:299845"
     SecStr          5..8
                     /sec_str_type="sheet"
                     /note="strand 40"
     Region          7..>93
                     /region_name="IG_like"
                     /note="Immunoglobulin like; smart00410"
                     /db_xref="CDD:214653"
     SecStr          10..13
                     /sec_str_type="sheet"
                     /note="strand 41"
     SecStr          14..24
                     /sec_str_type="sheet"
                     /note="strand 42"
     Bond            bond(22,96)
                     /bond_type="disulfide"
     SecStr          33..41
                     /sec_str_type="sheet"
                     /note="strand 43"
     SecStr          46..54
                     /sec_str_type="sheet"
                     /note="strand 44"
     SecStr          56..60
                     /sec_str_type="sheet"
                     /note="strand 45"
     SecStr          67..75
                     /sec_str_type="sheet"
                     /note="strand 46"
     SecStr          76..87
                     /sec_str_type="sheet"
                     /note="strand 47"
     SecStr          92..102
                     /sec_str_type="sheet"
                     /note="strand 48"
     SecStr          103..106
                     /sec_str_type="sheet"
                     /note="strand 49"
     SecStr          112..118
                     /sec_str_type="sheet"
                     /note="strand 50"
     Region          121..213
                     /region_name="Domain 10"
                     /note="NCBI Domains"
     SecStr          123..131
                     /sec_str_type="sheet"
                     /note="strand 51"
     Region          124..211
                     /region_name="Ig"
                     /note="Immunoglobulin domain; cl11960"
                     /db_xref="CDD:299845"
     SecStr          136..146
                     /sec_str_type="sheet"
                     /note="strand 52"
     Bond            bond(140,195)
                     /bond_type="disulfide"
     SecStr          150..155
                     /sec_str_type="sheet"
                     /note="strand 53"
     SecStr          162..167
                     /sec_str_type="sheet"
                     /note="strand 54"
     SecStr          168..172
                     /sec_str_type="sheet"
                     /note="strand 55"
     SecStr          173..183
                     /sec_str_type="sheet"
                     /note="strand 56"
     SecStr          193..201
                     /sec_str_type="sheet"
                     /note="strand 57"
     SecStr          202..210
                     /sec_str_type="sheet"
                     /note="strand 58"
ORIGIN                                                                53    55  56 57
        1 evqlqesgpg lvkpyqslsl sctvtgysit sdyawnwirq fpgnklewmg yity s  g  t   t  d  y
               63  64                                          98 99 100 101
       61 npsl k   s  risi trdtsknqff lqlnsvtted tatyycaryy y  g  y  w   y fdvwg qgttltvssa
      121 kttapsvypl apvssvtlgc lvkgyfpepv tltwnsgsls sgvhtfpavl qsdlytlsss
      181 vtvtsstwps qsitcnvahp asstkvdkki epr


CDR178	Residues      contacted in TaqP†	Number of van der Waals contacts (Number of H-bonds)	Buried surface area, Å2‡
L1 (Y32 Y34)	      Y545 P548 D547	5  (1)	41
L2 (D50 L54 G56)	  E471 R536 I546	3  (3)	83
L3 (S91 S92)	      R313 K314	2  (2)	64

H1	None	0  (0)	9
H2 (S53 T55 T56 D57 K63 S64)	S383 T385 T386 E388 E397 W398 A568 A570 R728	10  (15)	184
H3 (G98 Y99 W100 Y101)	S515 K542 S543 Y545 N580	15  (4)	128

FRAME (L46L Y49L V58L W105H)	P481 L484 N485 K511 R512 T544 Y545	8 
Retrieved from "https://eln.excellgen.com/index.php?title=Anti-Taq_Antibody&oldid=15612"