Anti-Taq Antibody
Jump to navigation
Jump to search
Patent 5,338, 671
TP4
https://www.atcc.org/products/all/HB-11126.aspx
TP4-9.2
https://www.atcc.org/products/all/HB-11807.aspx
TP9: HB-11127
Taq: 250,000 units/mg of protein.
Taq_antibody: US5587287
| Taq, Ka | Tth, Ka | Tfi, Ka | ||
| TP1 | IgG1 |
6.0E-09 | ||
| TP2 | IgG1 |
5.0E-09 |
3.0E-07 |
|
| TP3 | IgG2b |
2.5E-09 |
2.0E-08 | |
| TP4 | IgG2a |
1.5E-09 |
9.0E-09 |
|
| TP5 | IgG2b |
4.0E-09 |
2.0E-08 |
|
| TP6 | IgG2b |
2.5E-09 |
||
| TP7 | IgG2a |
1.0E-09 |
8.0E-09 |
8.0E-09 |
| TP8 | IgG2a |
3.0E-09 |
3.0E-08 |
|
| TP9 | IgG2a |
1.8E-09 |
1.0E-08 | 6.0E-09 |
TPl and TP6 have high affinity for
Thermus aquaticus DNA polymerase, but little affinity for the other two DNA polymerases. TP2, TP4, TP5 and TP8 have high a?'inity for the Thermus aquaticus and Thermus themzaphilus DNA polymerases. TP3 has high af?nity for the Thermus aquaticus and Thermus ?lzjformis DNA polymerases. TP7 and TP9 have high af?nity for all three DNA polymerases.
>1BGX:H|PDBID|CHAIN|SEQUENCE
EVQLQESGPGLVKPYQSLSLSCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGTTDYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARYYYGYWYFDVWGQGTTLTVSS
>1BGX:L|PDBID|CHAIN|SEQUENCE
DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELK
==============
EVQLQESGPGLVKPYQSLSLSCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGTTDYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARYYYGYWYFDVWGQGTTLTVSSAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Description: Recombinant monoclonal antibody to Taq-Polymerase. Manufactured using
AbAb’s Recombinant Platform with variable regions (i.e. specificity) from the hybridoma
TP7.
This reformatted mouse antibody was made using the variable domain sequences of
the original Mouse IgG2a format, for improved compatibility with existing reagents,
assays and techniques.
Isotype and Format: Mouse IgG1, kappa
Clone Number: TP7
Mouse antibody kappa light chain
LOCUS 1BGX_L 210 aa linear ROD 10-OCT-2012
DEFINITION Chain L, Taq Polymerase In Complex With Tp7, An Inhibitory Fab.
ACCESSION 1BGX_L
VERSION 1BGX_L GI:3891940
DBSOURCE pdb: molecule 1BGX, chain 76, release Jun 18, 2009;
deposition: Jun 2, 1998;
class: Complex (PolymeraseINHIBITOR);
source: Mmdb_id: 48162, Pdb_id 1: 1BGX;
Exp. method: X-Ray Diffraction.
KEYWORDS .
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (residues 1 to 210)
AUTHORS Murali,R., Helmer-Citterich,M., Sharkey,D.J., Scalice,E.R.,
Daiss,J.L., Sullivan,M.A. and Krishna Murthy,H.M.
TITLE Structural studies on an inhibitory antibody against Thermus
aquaticus DNA polymerase suggest mode of inhibition
JOURNAL Protein Eng. 11 (2), 79-86 (1998)
PUBMED 9605541
REFERENCE 2 (residues 1 to 210)
AUTHORS Murali,R., Sharkey,D.J., Daiss,J.L. and Murthy,H.M.
TITLE Crystal structure of Taq DNA polymerase in complex with an
inhibitory Fab: the Fab is directed against an intermediate in the
helix-coil dynamics of the enzyme
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (21), 12562-12567 (1998)
PUBMED 9770525
REFERENCE 3 (residues 1 to 210)
AUTHORS Murali,R., Sharkey,D.J., Daiss,J.L. and Krishna Murthy,H.M.
TITLE Direct Submission
JOURNAL Submitted (02-JUN-1998)
COMMENT SEQRES.
FEATURES Location/Qualifiers
source 1..210
/organism="Mus musculus"
/db_xref="taxon:10090"
Region 1..107
/region_name="Domain 7"
/note="NCBI Domains"
Region 2..105
/region_name="Ig"
/note="Immunoglobulin domain; cl11960"
/db_xref="CDD:276006"
SecStr 3..7
/sec_str_type="sheet"
/note="strand 21"
Region 8..104
/region_name="IG_like"
/note="Immunoglobulin like; smart00410"
/db_xref="CDD:214653"
SecStr 9..13
/sec_str_type="sheet"
/note="strand 22"
SecStr 15..26
/sec_str_type="sheet"
/note="strand 23"
Bond bond(23,87)
/bond_type="disulfide"
SecStr 31..38
/sec_str_type="sheet"
/note="strand 24"
SecStr 43..50
/sec_str_type="sheet"
/note="strand 25"
SecStr 51..54
/sec_str_type="sheet"
/note="strand 26"
SecStr 60..67
/sec_str_type="sheet"
/note="strand 27"
SecStr 68..74
/sec_str_type="sheet"
/note="strand 28"
SecStr 75..78
/sec_str_type="sheet"
/note="strand 29"
SecStr 82..89
/sec_str_type="sheet"
/note="strand 30"
SecStr 100..105
/sec_str_type="sheet"
/note="strand 31"
Region 108..210
/region_name="Domain 8"
/note="NCBI Domains"
SecStr 110..119
/sec_str_type="sheet"
/note="strand 32"
Region 111..210
/region_name="IgC_L"
/note="Immunoglobulin Constant domain; cd07699"
/db_xref="CDD:143323"
Site order(115..117,130,132,134,136..137,159..162,173..175,
206..207)
/site_type="other"
/note="heterodimer interface [polypeptide binding]"
/db_xref="CDD:143323"
SecStr 127..139
/sec_str_type="sheet"
/note="strand 33"
Bond bond(133,193)
/bond_type="disulfide"
Site order(139,164..165,170)
/site_type="other"
/note="intrachain IgV interface"
/db_xref="CDD:143323"
SecStr 143..150
/sec_str_type="sheet"
/note="strand 34"
SecStr 151..154
/sec_str_type="sheet"
/note="strand 35"
SecStr 157..163
/sec_str_type="sheet"
/note="strand 36"
SecStr 171..180
/sec_str_type="sheet"
/note="strand 37"
SecStr 181..188
/sec_str_type="helix"
/note="helix 22"
SecStr 189..197
/sec_str_type="sheet"
/note="strand 38"
SecStr 203..210
/sec_str_type="sheet"
/note="strand 39"
ORIGIN
32 34 50 54 56 57
1 diqmtqspai msaspgekvt mtcsasssvs y m y wyqqkpg ssprlliy d s tn l a s g vpvr
s91 92
61 fsgsgsgtsy sltisrmeae daatyycqqw s t ypltfgag tklelkrada aptvsifpps
121 seqltsggas vvcflnnfyp kdinvkwkid gserqngvln swtdqdskds tysmsstltl
181 tkdeyerhns ytceathkts tspivksfnr
L1 (Y32 Y34) Y545 P548 D547 5 (1) 41
L2 (D50 L54 G56) E471 R536 I546 3 (3) 83
L3 (S91 S92) R313 K314 2 (2) 64
Chain H anti taq Tp7
d1ay1h1 Immunoglobulin heavy chain variable domain, VH: 119 residues
d1ay1h2 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma: 94 residues
LOCUS 1BGX_H 213 aa linear ROD 10-OCT-2012
DEFINITION Chain H, Taq Polymerase In Complex With Tp7, An Inhibitory Fab.
ACCESSION 1BGX_H
VERSION 1BGX_H GI:3891939
DBSOURCE pdb: molecule 1BGX, chain 72, release Jun 18, 2009;
deposition: Jun 2, 1998;
class: Complex (PolymeraseINHIBITOR);
source: Mmdb_id: 48162, Pdb_id 1: 1BGX;
Exp. method: X-Ray Diffraction.
KEYWORDS .
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (residues 1 to 213)
AUTHORS Murali,R., Helmer-Citterich,M., Sharkey,D.J., Scalice,E.R.,
Daiss,J.L., Sullivan,M.A. and Krishna Murthy,H.M.
TITLE Structural studies on an inhibitory antibody against Thermus
aquaticus DNA polymerase suggest mode of inhibition
JOURNAL Protein Eng. 11 (2), 79-86 (1998)
PUBMED 9605541
REFERENCE 2 (residues 1 to 213)
AUTHORS Murali,R., Sharkey,D.J., Daiss,J.L. and Murthy,H.M.
TITLE Crystal structure of Taq DNA polymerase in complex with an
inhibitory Fab: the Fab is directed against an intermediate in the
helix-coil dynamics of the enzyme
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (21), 12562-12567 (1998)
PUBMED 9770525
REFERENCE 3 (residues 1 to 213)
AUTHORS Murali,R., Sharkey,D.J., Daiss,J.L. and Krishna Murthy,H.M.
TITLE Direct Submission
JOURNAL Submitted (02-JUN-1998)
COMMENT SEQRES.
FEATURES Location/Qualifiers
source 1..213
/organism="Mus musculus"
/db_xref="taxon:10090"
Region 1..120
/region_name="Domain 9"
/note="NCBI Domains"
Region 4..118
/region_name="Ig"
/note="Immunoglobulin domain; cl11960"
/db_xref="CDD:299845"
SecStr 5..8
/sec_str_type="sheet"
/note="strand 40"
Region 7..>93
/region_name="IG_like"
/note="Immunoglobulin like; smart00410"
/db_xref="CDD:214653"
SecStr 10..13
/sec_str_type="sheet"
/note="strand 41"
SecStr 14..24
/sec_str_type="sheet"
/note="strand 42"
Bond bond(22,96)
/bond_type="disulfide"
SecStr 33..41
/sec_str_type="sheet"
/note="strand 43"
SecStr 46..54
/sec_str_type="sheet"
/note="strand 44"
SecStr 56..60
/sec_str_type="sheet"
/note="strand 45"
SecStr 67..75
/sec_str_type="sheet"
/note="strand 46"
SecStr 76..87
/sec_str_type="sheet"
/note="strand 47"
SecStr 92..102
/sec_str_type="sheet"
/note="strand 48"
SecStr 103..106
/sec_str_type="sheet"
/note="strand 49"
SecStr 112..118
/sec_str_type="sheet"
/note="strand 50"
Region 121..213
/region_name="Domain 10"
/note="NCBI Domains"
SecStr 123..131
/sec_str_type="sheet"
/note="strand 51"
Region 124..211
/region_name="Ig"
/note="Immunoglobulin domain; cl11960"
/db_xref="CDD:299845"
SecStr 136..146
/sec_str_type="sheet"
/note="strand 52"
Bond bond(140,195)
/bond_type="disulfide"
SecStr 150..155
/sec_str_type="sheet"
/note="strand 53"
SecStr 162..167
/sec_str_type="sheet"
/note="strand 54"
SecStr 168..172
/sec_str_type="sheet"
/note="strand 55"
SecStr 173..183
/sec_str_type="sheet"
/note="strand 56"
SecStr 193..201
/sec_str_type="sheet"
/note="strand 57"
SecStr 202..210
/sec_str_type="sheet"
/note="strand 58"
ORIGIN 53 55 56 57
1 evqlqesgpg lvkpyqslsl sctvtgysit sdyawnwirq fpgnklewmg yity s g t t d y
63 64 98 99 100 101
61 npsl k s risi trdtsknqff lqlnsvtted tatyycaryy y g y w y fdvwg qgttltvssa
121 kttapsvypl apvssvtlgc lvkgyfpepv tltwnsgsls sgvhtfpavl qsdlytlsss
181 vtvtsstwps qsitcnvahp asstkvdkki epr
CDR178 Residues contacted in TaqP† Number of van der Waals contacts (Number of H-bonds) Buried surface area, Å2‡
L1 (Y32 Y34) Y545 P548 D547 5 (1) 41
L2 (D50 L54 G56) E471 R536 I546 3 (3) 83
L3 (S91 S92) R313 K314 2 (2) 64
H1 None 0 (0) 9
H2 (S53 T55 T56 D57 K63 S64) S383 T385 T386 E388 E397 W398 A568 A570 R728 10 (15) 184
H3 (G98 Y99 W100 Y101) S515 K542 S543 Y545 N580 15 (4) 128
FRAME (L46L Y49L V58L W105H) P481 L484 N485 K511 R512 T544 Y545 8